2015 CHRYSLER 300 air condition

•TheAdvancedFrontAirBagswillnotdeployinallfrontalcollisions,includingsomethatmayproduce substantial vehicle damage — for example, some pole collisions, truck underrides, andangle offset collisions.
•Ontheotherhand,dependingonthetypeandlocationofimpact,AdvancedFrontAirBagsmay deploy in crashes with little vehicle front-end damage but that produce a severe initialdeceleration.
•Becauseairbagsensorsmeasurevehicledecelerationovertime,vehiclespeedanddamagebythemselves are not good indicators of whether or not an air bag should have deployed.
•Seatbeltsarenecessaryforyourprotectioninallcollisions,andalsoareneededtohelpkeep
you in position, away from an inflating air bag.
•Theairbagsmustbereadytoinflateforyourprotectioninacollision.TheOccupantRestraintController (ORC) monitors the internal circuits and interconnecting wiring associated with airbag system electrical components.
•TheORCturnsontheAirBagWarningLightintheinstrumentpanelforapproximatelyfourto eight seconds for a self-check when the ignition switch is first turned to the ON/RUNposition. After the self-check, the Air Bag Warning Light will turn off. If the ORC detects amalfunction in any part of the system, it turns on the Air Bag Warning Light, either momen-tarily or continuously. A single chime will sound to alert you if the light comes on again afterinitial startup.
•TheORCmonitorsthereadinessoftheelectronicpartsoftheairbagsystemwhenevertheignition switch is in the START or ON/RUN position. If the ignition switch is in the OFFposition or in the ACC position, the air bag system is not on and the air bags will not inflate.
•IftheAirBagWarningLightintheinstrumentpanelisnotonduringthefourtoeightsecondswhen the ignition switch is first turned to the ON/RUN position, stays on, or turns on whiledriving, have the vehicle serviced by an authorized service center immediately.
NOTE:
If the speedometer, tachometer, or any engine related gauges are not working, the Occupant
Restraint Controller (ORC ) may also be disabled. In this condition the air bags may not be ready
to inflate for your protection. Have an authorized dealer service the air bag system immediately.
•Afteranycollision,thevehicleshouldbetakentoanauthorizeddealerimmediately.
•Donotdriveyourvehicleaftertheairbagshave deployed. If you are involved in anothercollision, the air bags will not be in place to protect you.
•Ifitisnecessarytomodifytheairbagsystemforpersonswithdisabilities,contactyourauthorized dealer.
•Referto“SupplementalRestraintSystem(SRS)”in“ThingsToKnowBeforeStartingYour
Ve h i c l e ” i n t h e O w n e r ' s M a n u a l o n t h e D V D f o r f u r t h e r i n f o r m a t i o n .
GETTING STARTED
16

Automatic Operation
The climate system will automatically adjust settings to achieve and maintain comfort.
• Press the AUTO button.
•SelectthedesiredtemperaturebypushingtheTemperatureControlsforthedriverand/or
passenger.
Air Conditioning (A/C)
If the air conditioning button is pressed while in AUTO mode, the system will exit AUTO mode
and stay in A/C. The mode and blower will be set at the closest mode and blower position that the
system was operating in AUTO.
Automatic Climate Control Knobs
1 — FRONT Defroster Button2—DriverTemperatureUp3 — Blower Control Knob4 — Passenger Temperature Up5 — A/C Button6 — Air Recirculation Button
7 — Passenger Temperature Down8 — Off Button9 — AUTO Button10 — Driver Temperature Down11 — REAR Defroster Button
OPERATING YOUR VEHICLE
47

MAX A/C
MAX A/C sets the control for maximum cooling performance.
• Press and release to toggle between MAX A/C and the prior settings. The button on the
touchscreen illuminates when MAX A/C is ON.
In MAX A/C, the blower level and mode position can be adjusted to desired user settings.
Pressing other settings will cause the MAX A/C operation to switch to the prior settings and the
MAX A/C indicator will turn off.
SYNC Temperature Button
•Pressthe“SYNC”buttononcetocontroldriverandpassengertemperaturessimultaneously.
• Press the “SYNC” button a second time to control the temperatures individually.
Air Recirculation
• Use Recirculation for maximum A/C operation.
• For window defogging, turn the Recirculation button off.
• If the Recirculation button is pushed while in the AUTO mode, the indicator light may flash
three times to indicate the cabin air is being controlled automatically. The Recirculation button
will be greyed out in these conditions.
Heated Mirrors
The mirrors are heated to melt frost or ice. This feature is activated whenever you turn on the rear
window defroster.
BLIND SPOT MONITORING
The Blind Spot Monitoring (BSM) system uses two radar-based sensors, located inside the rear
bumper fascia, to detect Highway licensable vehicles (automobiles, trucks, motorcycles etc.) that
enter the blind spot zones from the rear/front/side of the vehicle.
The Blind Spot Monitoring (BSM) system warning light, located in the outside mirrors, will
illuminate if a vehicle moves into a blind spot zone.
The BSM system can also be configured to sound an audible (chime) alert and mute the radio to
notify you of objects that have entered the detection zones.
Refer to “Blind Spot Monitoring” in “Understanding The Features Of Your Vehicle” in your
Owner's Manual on the DVD for further details.
OPERATING YOUR VEHICLE
48

Selling Your Vehicle
When you sell your vehicle, we recommend that you remove your Uconnect® Access Account
information from the vehicle. You can do this using the radio touchscreen in the vehicle or on the
Mopar Owner Connect website (moparownerconnect.com). Removing your account informa-
tion cancels your subscription and makes your vehicle factory-ready for a new owner/subscriber.
1. From your vehicle’s radio touchscreen, select “Uconnect® Store” from the Apps Menu.
2. Select “My Apps,” then “Settings.” Press “Remove Uconnect® Account.”
3. Enter your Uconnect® Security PIN, and select “Continue.”
For additional information on Uconnect®:
•U.S.residents-visitDriveUconnect.comorcall1-877-855-8400.
•CanadianResidents-visitDriveUconnect.caorcall,1-800-465-2001(English)or
1-800-387-9983 (French).
Built-In Features (Uconnect® 8.4A/8.4AN)
CAUTION!
•Ignoringtherearviewmirrorlightcouldmeanyoumaynothave9-1-1Callserviceif
needed. If the rearview mirror light is illuminated, have an authorized dealer service the
9-1-1 Call system immediately.
•TheOccupantRestraintController(ORC)turnsontheAirBagWarningLightonthe
instrument panel if a malfunction is detected in any part of the air bag system. If the Air
Bag Warning Light is illuminated, the air bag system may not be working properly and the
9-1-1 system may not be able to send a signal to a 9-1-1 operator. If the Air Bag Warning
Light is illuminated, have an authorized dealer service your vehicle immediately.
•Ifanyoneinthevehiclecouldbeindanger(e.g.,fireorsmokeisvisible,dangerousroad
conditions or location), do not wait for voice contact from a 9-1-1 operator. All occupants
should exit the vehicle immediately and move to a safe location.
•Donotaddanyaftermarketelectricalequipmenttothevehicle’selectricalsystem.This
may prevent your vehicle from sending a signal to initiate an emergency call. To avoid
interference that can cause the 9-1-1 Call system to fail, never add aftermarket equipment
(e.g., two-way mobile radio, CB radio, data recorder, etc.) to your vehicle’s electrical
system or modify the antennas on your vehicle. IF YOUR VEHICLE LOSES BATTERY
POWER FOR ANY REASON (INCLUDING DURING OR AFTER AN ACCI-
DENT), THE UCONNECT® FEATURES, APPS AND SERVICES, AMONG OTH-
ERS, WILL NOT OPERATE.
ELECTRONICS
61

NOTE:
AFTER INFLATION, THE VEHICLE MAY NEED TO BE DRIVEN FOR 20 MINUTES
BEFORE THE FLASHING LIGHT WILL TURN OFF.
Please note that the TPMS is not a substitute for proper tire maintenance, and it is the driver’s
responsibility to maintain correct tire pressure, even if under-inflation has not reached the level to
trigger illumination of the TPMS low tire pressure telltale.
Yo u r v e h i c l e h a s a l s o b e e n e q u i p p e d w i t h a T P M S m a l f u n c t i o n i n d i c a t o r t o i n d i c a t e w h e n t h e
system is not operating properly. The TPMS malfunction indicator is combined with the low tire
pressure telltale.
When the system detects a malfunction, the telltale will flash for approximately one minute and
then remain continuously illuminated. This sequence will continue upon subsequent vehicle
start-ups as long as the malfunction exists. When the malfunction indicator is illuminated, the
system may not be able to detect or signal low tire pressure as intended. TPMS malfunctions may
occur for a variety of reasons, including the installation of replacement or alternate tires or wheels
on the vehicle that prevent the TPMS from functioning properly. Always check the TPMS
malfunction telltale after replacing one or more tires or wheels on your vehicle to ensure that the
replacement or alternate tires and wheels allow the TPMS to continue to function properly.
NOTE:
Tire pressures change by approximately 1 psi (7 kPa) per 12° F (7° C) of air temperature change.
Keep this in mind when checking tire pressure inside a garage, especially in the Winter. Example:
If garage temperature is 68°F (20°C), and the outside temperature is 32°F (0°C), then the cold
tire inflation pressure should be increased by 3 psi (21 kPa), which equals 1 psi (7 kPa) for every
12°F (7°C) for this outside temperature condition.
CAUTION!
The TPMS has been optimized for the original equipment tires and wheels. TPMS pressures
and warning have been established for the tire size equipped on your vehicle. Undesirable
system operation or sensor damage may result when using replacement equipment that is not
of the same size, type, and/or style. Aftermarket wheels can cause sensor damage. Do not use
tire sealant from a can, or balance beads if your vehicle is equipped with a TPMS, as damage
to the sensors may result.
–EngineTemperatureWarningLight
This light warns of an overheated engine condition.
If the light turns on or flashes continuously while driving, safely pull over and stop the vehicle. If
the A/C system is on, turn it off. Also, shift the transmission into NEUTRAL and idle the vehicle.
If the temperature reading does not return to normal, turn the engine off immediately.
We r e c o m m e n d t h a t y o u d o n o t o p e r a t e t h e v e h i c l e o r e n g i n e d a m a g e w i l l o c c u r. H a v e t h e
vehicle serviced immediately.
WHAT TO DO IN EMERGENCIES
127

WARNING!
Ahotenginecoolingsystemisdangerous.Youorotherscouldbebadlyburnedbysteamor
boiling coolant.
–BrakeWarningLight
This light monitors various brake functions, including brake fluid level and parking brake appli-
cation. If the brake light turns on, it may indicate that the parking brake is applied, that the brake
fluid level is low, or that there is a problem with the anti-lock brake system reservoir.
If the light remains on when the parking brake has been disengaged, and the fluid level is at the
full mark on the master cylinder reservoir, it indicates a possible brake hydraulic system malfunc-
tion or that a problem with the Brake Booster has been detected by the Anti-Lock Brake System
(ABS)/Electronic Stability Control (ESC) system. In this case, the light will remain on until the
condition has been corrected. If the problem is related to the brake booster, the ABS pump will
run when applying the brake, and a brake pedal pulsation may be felt during each stop.
The dual brake system provides a reserve braking capacity in the event of a failure to a portion of
the hydraulic system. A leak in either half of the dual brake system is indicated by the Brake
Wa r n i n g L i g h t , w h i c h w i l l t u r n o n w h e n t h e b r a k e f l u i d l e v e l i n t h e m a s t e r c y l i n d e r h a s d r o p p e d
below a specified level. The light will remain on until the cause is corrected.
Ve h i c l e s e q u i p p e d w i t h t h e A n t i - L o c k B r a k e S y s t e m ( A B S ) a r e a l s o e q u i p p e d w i t h E l e c t r o n i c
Brake Force Distribution (EBD). In the event of an EBD failure, the Brake Warning Light will turn
on along with the ABS Light. Immediate repair to the ABS system is required.
Operation of the Brake Warning Light can be checked by turning the ignition switch from the
OFF position to the ON/RUN position. The light should illuminate for approximately two
seconds. The light should then turn off unless the parking brake is applied or a brake fault is
detected. If the light does not illuminate, have the light inspected by an authorized dealer.
The light also will turn on when the parking brake is applied with the ignition switch in the
ON/RUN position.
NOTE:
This light shows only that the parking brake is applied. It does not show the degree of brake
application.
WARNING!
Driving a vehicle with the red brake light on is dangerous. Part of the brake system may have
failed. It will take longer to stop the vehicle. You could have a collision. Have the vehicle
checked immediately.
Malfunction Indicator Light (MIL)
Certain conditions, such as a poor fuel quality, etc., may illuminate the MIL after engine start. The
vehicle should be serviced if the light stays on through several typical driving cycles. In most
situations, the vehicle will drive normally and not require towing.
WHAT TO DO IN EMERGENCIES
128

If the MIL flashes when the engine is running, serious conditions may exist that could lead to
immediate loss of power or severe catalytic converter damage. We recommend you do not
operate the vehicle. Have the vehicle serviced immediately.
–ElectronicStabilityControl(ESC)OFFIndicatorLight
This light indicates the Electronic Stability Control (ESC) is off.
Charging System Light
This light shows the status of the electrical charging system. If the charging system light remains
on, it means that the vehicle is experiencing a problem with the charging system.
We r e c o m m e n d y o u d o n o t c o n t i n u e d r i v i n g i f t h e c h a r g i n g s y s t e m l i g h t i s o n . H a v e t h e v e h i c l e
serviced immediately.
–OilPressureWarningLight
This light indicates low engine oil pressure. If the light turns on while driving, stop the vehicle and
shut off the engine as soon as possible. A chime will sound when this light turns on.
We r e c o m m e n d y o u d o n o t o p e r a t e t h e v e h i c l e o r e n g i n e d a m a g e w i l l o c c u r. H a v e t h e v e h i c l e
serviced immediately.
–Anti-LockBrake(ABS)Light
This light monitors the Anti-Lock Brake System (ABS).
If the light is not on during starting, stays on or turns on while driving, we recommend you contact
the nearest authorized dealer and have the vehicle serviced immediately.
–ElectronicThrottleControl(ETC)IndicatorLight
This light informs you of a problem with the system.
If a problem is detected, the light will come on while the engine is running. Cycle the ignition
when the vehicle has completely stopped and the shift lever is placed in the PARK position; the
light should turn off.
If the light remains lit with the engine running, your vehicle will usually be drivable. However, see
an authorized dealer immediately. If the light is flashing when the engine is running, immediate
service is required, and you may experience reduced performance, an elevated/rough idle or
engine stall, and your vehicle may require towing.
–AirBagWarningLight
If the light is not on during starting, stays on, or turns on while driving, have the vehicle serviced
by an authorized dealer immediately.
SERVICE AWD SYSTEM Message
If the SERVICE AWD SYSTEM warning message appears after engine start up, or during
driving, it means the AWD system is not functioning properly. We recommend you do not
operate the vehicle. Have the vehicle serviced immediately.
WHAT TO DO IN EMERGENCIES
129

IF YOUR ENGINE OVERHEATS
In any of the following situations, you can reduce the potential for overheating by taking the
appropriate action:
•Onthehighways—slowdown.
• In city traffic — while stopped, shift the transmission to NEUTRAL, but do not increase engine
idle speed.
NOTE:
There are steps that you can take to slow down an impending overheat condition:
•Ifyourairconditioner(A/C)ison,turnitoff.TheA/Csystemaddsheattotheenginecooling
system and turning the A/C off can help remove this heat.
• You can also turn the temperature control to maximum heat, the mode control to floor and the
blower control to high. This allows the heater core to act as a supplement to the radiator and
aids in removing heat from the engine cooling system.
CAUTION!
Driving with a hot cooling system could damage your vehicle. If the temperature gauge reads
HOT (H), pull over and stop the vehicle. Idle the vehicle with the air conditioner turned off
until the pointer drops back into the normal range. If the pointer remains on HOT (H), and
you hear continuous chimes, turn the engine off immediately, and call for service.
WARNING!
Yo u o r o t h e r s c a n b e b a d l y b u r n e d b y h o t e n g i n e c o o l a n t ( a n t i f r e e z e ) o r s t e a m f r o m y o u r
radiator. If you see or hear steam coming from under the hood, do not open the hood until the
radiator has had time to cool. Never try to open a cooling system pressure cap when the
radiator or coolant bottle is hot.
JACKING AND TIRE CHANGING
Jack Location/Spare Tire Stowage
The jack and spare tire are both stowed under an access cover in the trunk. Follow these steps to
access the jack and spare tire.
NOTE:
The spare tire must be removed in order to access the jack.
1. Open the trunk.
WHAT TO DO IN EMERGENCIES
132