2015 CHRYSLER 300 warning

Uconnect® ACCESS
Uconnect® Access — If Equipped (Available On Uconnect® 8.4A/8.4AN
—U.S.ResidentsOnly)
WARNING!
ALWAYS drive safely with your hands on the steering wheel. You have full responsibility and
assume all risks related to the use of the Uconnect® features and applications in this vehicle.
Only use Uconnect® when it is safe to do so. Failure to do so may result in an accident involving
serious injury or death.
Uconnect® Access enhances your ownership and driving experience by connecting your vehicle
with a built-in cellular connection. With Uconnect® Access, you can:
• Place a call to a local 9-1-1 Operator for emergency assistance.
•Remotelylock/unlockyourdoorsandstartyourvehiclefromvirtuallyanywhere,usingthe
Uconnect® Access App from your smartphone. You can also do so by logging into Mopar
Owner Connect, or by calling Uconnect® Care. (Vehicle must be within the United States and
have network coverage).
•TurnyourvehicleintoaWiFiHotspotandconnectyourdevicestotheinternet.
•Receivetextoremailnotificationsifyourvehicle'stheftalarmgoesoff.
•Receivestolenvehicleassistance,usingGPStechnologytohelpauthoritieslocateyour
vehicle if it is stolen.
•Listentoyourtextmessagesorsendfree-formtextmessageswithyourvoicewhilekeeping
your hands on the wheel, using the Voice Texting feature. Requires a cell phone that supports
Bluetooth Message Access Profile (MAP).
•Searchforplacestoeat,shop,relaxandplaywithYelp®,usingyourvoiceoron-screenmenu.
Then navigate to them (navigation standard on Uconnect® 8.4AN, optional on Uconnect®
8.4A).
•GetoperatorassistanceusingtheASSISTbuttononyourinteriorrearviewmirror.
Before you drive, familiarize yourself with the easy-to-use Uconnect® Access.
1. The ASSIST and 9-1-1 buttons are located on your rearview mirror. The ASSIST button is used
for contacting Roadside Assistance, Vehicle Care and Uconnect® Care. The 9-1-1 button
connects you to emergency services.
NOTE:
Ve h i c l e s s o l d i n C a n a d a a n d M e x i c o D O N O T h a v e 9 - 1 - 1 C a l l s y s t e m c a p a b i l i t i e s . 9 - 1 - 1 o r
other emergency line operators in Canada and Mexico may not answer or respond to 9-1-1
system calls.
2. The Uconnect® “Apps” button on the menu bar at the bottom right corner of the radio
touchscreen. This is where you can begin your registration process, manage your Apps and
purchase WiFi on demand.
ELECTRONICS
55

Selling Your Vehicle
When you sell your vehicle, we recommend that you remove your Uconnect® Access Account
information from the vehicle. You can do this using the radio touchscreen in the vehicle or on the
Mopar Owner Connect website (moparownerconnect.com). Removing your account informa-
tion cancels your subscription and makes your vehicle factory-ready for a new owner/subscriber.
1. From your vehicle’s radio touchscreen, select “Uconnect® Store” from the Apps Menu.
2. Select “My Apps,” then “Settings.” Press “Remove Uconnect® Account.”
3. Enter your Uconnect® Security PIN, and select “Continue.”
For additional information on Uconnect®:
•U.S.residents-visitDriveUconnect.comorcall1-877-855-8400.
•CanadianResidents-visitDriveUconnect.caorcall,1-800-465-2001(English)or
1-800-387-9983 (French).
Built-In Features (Uconnect® 8.4A/8.4AN)
CAUTION!
•Ignoringtherearviewmirrorlightcouldmeanyoumaynothave9-1-1Callserviceif
needed. If the rearview mirror light is illuminated, have an authorized dealer service the
9-1-1 Call system immediately.
•TheOccupantRestraintController(ORC)turnsontheAirBagWarningLightonthe
instrument panel if a malfunction is detected in any part of the air bag system. If the Air
Bag Warning Light is illuminated, the air bag system may not be working properly and the
9-1-1 system may not be able to send a signal to a 9-1-1 operator. If the Air Bag Warning
Light is illuminated, have an authorized dealer service your vehicle immediately.
•Ifanyoneinthevehiclecouldbeindanger(e.g.,fireorsmokeisvisible,dangerousroad
conditions or location), do not wait for voice contact from a 9-1-1 operator. All occupants
should exit the vehicle immediately and move to a safe location.
•Donotaddanyaftermarketelectricalequipmenttothevehicle’selectricalsystem.This
may prevent your vehicle from sending a signal to initiate an emergency call. To avoid
interference that can cause the 9-1-1 Call system to fail, never add aftermarket equipment
(e.g., two-way mobile radio, CB radio, data recorder, etc.) to your vehicle’s electrical
system or modify the antennas on your vehicle. IF YOUR VEHICLE LOSES BATTERY
POWER FOR ANY REASON (INCLUDING DURING OR AFTER AN ACCI-
DENT), THE UCONNECT® FEATURES, APPS AND SERVICES, AMONG OTH-
ERS, WILL NOT OPERATE.
ELECTRONICS
61

WARNING!
•Yourmotorizeddoororgatewillopenandclosewhileyouareprogrammingtheuniversal
transceiver. Do not program the transceiver if people or pets are in the path of the door or
gate.
•Donotrunyourvehicleinaclosedgarageorconfinedareawhileprogrammingthe
transceiver. Exhaust gas from your vehicle contains Carbon Monoxide (CO) which is
odorless and colorless. Carbon Monoxide is poisonous when inhaled and can cause you
and others to be severely injured or killed.
POWER OUTLETS
There are two 12 Volt electrical outlets on this vehicle.
The front 12 Volt power outlet has power available only when the ignition is placed in the ACC or
RUN position.
The center console outlet is powered directly from the battery (power available at all times).
Items plugged into this outlet may discharge the battery and/or prevent the engine from starting.
NOTE:
• Do not exceed the maximum power of
160 Watts (13 Amps) at 12 Volts. If the
160 Watt (13 Amp) power rating is ex-
ceeded, the fuse protecting the system will
need to be replaced.
• Power outlets are designed for accessory
plugs only. Do not insert any other object in
the power outlet as this will damage the
outlet and blow the fuse. Improper use of
the power outlet can cause damage not cov-
ered by your new vehicle warranty.
Front Power Outlet
Center Console Power Outlet
ELECTRONICS
123

ROADSIDE ASSISTANCE
Dial toll-free 1-800-521-2779 for U.S. Residents or 1-800-363-4869 for Canadian Residents.
•Provideyourname,vehicleidentificationnumber,licenseplatenumber,andyourlocation,
including the telephone number from which you are calling.
• Briefly describe the nature of the problem and answer a few simple questions.
•Youwillbegiventhenameoftheserviceproviderandanestimatedtimeofarrival.Ifyoufeel
you are in an “unsafe situation”, please let us know. With your consent, we will contact local
police or safety authorities.
INSTRUMENT CLUSTER WARNING LIGHTS
–ElectronicStabilityControl(ESC)Activation/Malfunction
Indicator Light
The “ESC Activation/Malfunction Indicator Light” in the instrument cluster will come on when
the ignition switch is turned to the ON/RUN position. It should go out with the engine running.
If the “ESC Activation/Malfunction Indicator Light” comes on continuously with the engine
running, a malfunction has been detected in the ESC system.
If this light remains on after several ignition cycles,andthevehiclehasbeendrivenseveralmiles
(kilometers) at speeds greater than 30 mph (48 km/h), we recommend you drive to the nearest
service center and have the vehicle serviced immediately.
–TirePressureMonitoringSystem(TPMS)Light
Each tire, including the spare (if provided), should be checked monthly when cold and inflated to
the inflation pressure recommended by the vehicle manufacturer on the vehicle placard or tire
inflation pressure label. (If your vehicle has tires of a different size than the size indicated on the
vehicle placard or tire inflation pressure label, you should determine the proper tire inflation
pressure for those tires).
As an added safety feature, your vehicle has been equipped with a tire pressure monitoring
system (TPMS) that illuminates a low tire pressure telltale when one or more of your tires is
significantly under-inflated. Accordingly, when the low tire pressure telltale illuminates, you
should stop and check your tires as soon as possible and inflate them to the proper pressure.
Driving on a significantly under-inflated tire causes the tire to overheat and can lead to tire failure.
Under-inflation also reduces fuel efficiency and tire tread life and may affect the vehicle’s
handling and stopping ability.
IF THE LIGHT STARTS FLASHING INDICATING A LOW TIRE PRESSURE, ADJUST
THE AIR PRESSURE IN THE LOW TIRE TO THE AIR PRESSURE SHOWN ON THE
VEHICLE PLACARD OR TIRE INFLATION PRESSURE LABEL LOCATED ON THE
DRIVER'S DOOR.
WHAT TO DO IN EMERGENCIES
126

NOTE:
AFTER INFLATION, THE VEHICLE MAY NEED TO BE DRIVEN FOR 20 MINUTES
BEFORE THE FLASHING LIGHT WILL TURN OFF.
Please note that the TPMS is not a substitute for proper tire maintenance, and it is the driver’s
responsibility to maintain correct tire pressure, even if under-inflation has not reached the level to
trigger illumination of the TPMS low tire pressure telltale.
Yo u r v e h i c l e h a s a l s o b e e n e q u i p p e d w i t h a T P M S m a l f u n c t i o n i n d i c a t o r t o i n d i c a t e w h e n t h e
system is not operating properly. The TPMS malfunction indicator is combined with the low tire
pressure telltale.
When the system detects a malfunction, the telltale will flash for approximately one minute and
then remain continuously illuminated. This sequence will continue upon subsequent vehicle
start-ups as long as the malfunction exists. When the malfunction indicator is illuminated, the
system may not be able to detect or signal low tire pressure as intended. TPMS malfunctions may
occur for a variety of reasons, including the installation of replacement or alternate tires or wheels
on the vehicle that prevent the TPMS from functioning properly. Always check the TPMS
malfunction telltale after replacing one or more tires or wheels on your vehicle to ensure that the
replacement or alternate tires and wheels allow the TPMS to continue to function properly.
NOTE:
Tire pressures change by approximately 1 psi (7 kPa) per 12° F (7° C) of air temperature change.
Keep this in mind when checking tire pressure inside a garage, especially in the Winter. Example:
If garage temperature is 68°F (20°C), and the outside temperature is 32°F (0°C), then the cold
tire inflation pressure should be increased by 3 psi (21 kPa), which equals 1 psi (7 kPa) for every
12°F (7°C) for this outside temperature condition.
CAUTION!
The TPMS has been optimized for the original equipment tires and wheels. TPMS pressures
and warning have been established for the tire size equipped on your vehicle. Undesirable
system operation or sensor damage may result when using replacement equipment that is not
of the same size, type, and/or style. Aftermarket wheels can cause sensor damage. Do not use
tire sealant from a can, or balance beads if your vehicle is equipped with a TPMS, as damage
to the sensors may result.
–EngineTemperatureWarningLight
This light warns of an overheated engine condition.
If the light turns on or flashes continuously while driving, safely pull over and stop the vehicle. If
the A/C system is on, turn it off. Also, shift the transmission into NEUTRAL and idle the vehicle.
If the temperature reading does not return to normal, turn the engine off immediately.
We r e c o m m e n d t h a t y o u d o n o t o p e r a t e t h e v e h i c l e o r e n g i n e d a m a g e w i l l o c c u r. H a v e t h e
vehicle serviced immediately.
WHAT TO DO IN EMERGENCIES
127

WARNING!
Ahotenginecoolingsystemisdangerous.Youorotherscouldbebadlyburnedbysteamor
boiling coolant.
–BrakeWarningLight
This light monitors various brake functions, including brake fluid level and parking brake appli-
cation. If the brake light turns on, it may indicate that the parking brake is applied, that the brake
fluid level is low, or that there is a problem with the anti-lock brake system reservoir.
If the light remains on when the parking brake has been disengaged, and the fluid level is at the
full mark on the master cylinder reservoir, it indicates a possible brake hydraulic system malfunc-
tion or that a problem with the Brake Booster has been detected by the Anti-Lock Brake System
(ABS)/Electronic Stability Control (ESC) system. In this case, the light will remain on until the
condition has been corrected. If the problem is related to the brake booster, the ABS pump will
run when applying the brake, and a brake pedal pulsation may be felt during each stop.
The dual brake system provides a reserve braking capacity in the event of a failure to a portion of
the hydraulic system. A leak in either half of the dual brake system is indicated by the Brake
Wa r n i n g L i g h t , w h i c h w i l l t u r n o n w h e n t h e b r a k e f l u i d l e v e l i n t h e m a s t e r c y l i n d e r h a s d r o p p e d
below a specified level. The light will remain on until the cause is corrected.
Ve h i c l e s e q u i p p e d w i t h t h e A n t i - L o c k B r a k e S y s t e m ( A B S ) a r e a l s o e q u i p p e d w i t h E l e c t r o n i c
Brake Force Distribution (EBD). In the event of an EBD failure, the Brake Warning Light will turn
on along with the ABS Light. Immediate repair to the ABS system is required.
Operation of the Brake Warning Light can be checked by turning the ignition switch from the
OFF position to the ON/RUN position. The light should illuminate for approximately two
seconds. The light should then turn off unless the parking brake is applied or a brake fault is
detected. If the light does not illuminate, have the light inspected by an authorized dealer.
The light also will turn on when the parking brake is applied with the ignition switch in the
ON/RUN position.
NOTE:
This light shows only that the parking brake is applied. It does not show the degree of brake
application.
WARNING!
Driving a vehicle with the red brake light on is dangerous. Part of the brake system may have
failed. It will take longer to stop the vehicle. You could have a collision. Have the vehicle
checked immediately.
Malfunction Indicator Light (MIL)
Certain conditions, such as a poor fuel quality, etc., may illuminate the MIL after engine start. The
vehicle should be serviced if the light stays on through several typical driving cycles. In most
situations, the vehicle will drive normally and not require towing.
WHAT TO DO IN EMERGENCIES
128

If the MIL flashes when the engine is running, serious conditions may exist that could lead to
immediate loss of power or severe catalytic converter damage. We recommend you do not
operate the vehicle. Have the vehicle serviced immediately.
–ElectronicStabilityControl(ESC)OFFIndicatorLight
This light indicates the Electronic Stability Control (ESC) is off.
Charging System Light
This light shows the status of the electrical charging system. If the charging system light remains
on, it means that the vehicle is experiencing a problem with the charging system.
We r e c o m m e n d y o u d o n o t c o n t i n u e d r i v i n g i f t h e c h a r g i n g s y s t e m l i g h t i s o n . H a v e t h e v e h i c l e
serviced immediately.
–OilPressureWarningLight
This light indicates low engine oil pressure. If the light turns on while driving, stop the vehicle and
shut off the engine as soon as possible. A chime will sound when this light turns on.
We r e c o m m e n d y o u d o n o t o p e r a t e t h e v e h i c l e o r e n g i n e d a m a g e w i l l o c c u r. H a v e t h e v e h i c l e
serviced immediately.
–Anti-LockBrake(ABS)Light
This light monitors the Anti-Lock Brake System (ABS).
If the light is not on during starting, stays on or turns on while driving, we recommend you contact
the nearest authorized dealer and have the vehicle serviced immediately.
–ElectronicThrottleControl(ETC)IndicatorLight
This light informs you of a problem with the system.
If a problem is detected, the light will come on while the engine is running. Cycle the ignition
when the vehicle has completely stopped and the shift lever is placed in the PARK position; the
light should turn off.
If the light remains lit with the engine running, your vehicle will usually be drivable. However, see
an authorized dealer immediately. If the light is flashing when the engine is running, immediate
service is required, and you may experience reduced performance, an elevated/rough idle or
engine stall, and your vehicle may require towing.
–AirBagWarningLight
If the light is not on during starting, stays on, or turns on while driving, have the vehicle serviced
by an authorized dealer immediately.
SERVICE AWD SYSTEM Message
If the SERVICE AWD SYSTEM warning message appears after engine start up, or during
driving, it means the AWD system is not functioning properly. We recommend you do not
operate the vehicle. Have the vehicle serviced immediately.
WHAT TO DO IN EMERGENCIES
129

IF YOUR ENGINE OVERHEATS
In any of the following situations, you can reduce the potential for overheating by taking the
appropriate action:
•Onthehighways—slowdown.
• In city traffic — while stopped, shift the transmission to NEUTRAL, but do not increase engine
idle speed.
NOTE:
There are steps that you can take to slow down an impending overheat condition:
•Ifyourairconditioner(A/C)ison,turnitoff.TheA/Csystemaddsheattotheenginecooling
system and turning the A/C off can help remove this heat.
• You can also turn the temperature control to maximum heat, the mode control to floor and the
blower control to high. This allows the heater core to act as a supplement to the radiator and
aids in removing heat from the engine cooling system.
CAUTION!
Driving with a hot cooling system could damage your vehicle. If the temperature gauge reads
HOT (H), pull over and stop the vehicle. Idle the vehicle with the air conditioner turned off
until the pointer drops back into the normal range. If the pointer remains on HOT (H), and
you hear continuous chimes, turn the engine off immediately, and call for service.
WARNING!
Yo u o r o t h e r s c a n b e b a d l y b u r n e d b y h o t e n g i n e c o o l a n t ( a n t i f r e e z e ) o r s t e a m f r o m y o u r
radiator. If you see or hear steam coming from under the hood, do not open the hood until the
radiator has had time to cool. Never try to open a cooling system pressure cap when the
radiator or coolant bottle is hot.
JACKING AND TIRE CHANGING
Jack Location/Spare Tire Stowage
The jack and spare tire are both stowed under an access cover in the trunk. Follow these steps to
access the jack and spare tire.
NOTE:
The spare tire must be removed in order to access the jack.
1. Open the trunk.
WHAT TO DO IN EMERGENCIES
132